Get 20% from all friends orders that you'll refer to us. Share your affiliate link with them and start earning.
FREE SHIPPING 
for orders over 250$ 

Magnus Pharma

Product Compare (0)


ANASTRAZOLE 1 mg 30 Tablets Magnus Pharma

Uses:Anastrozole is used to treat breast cancer in women after menopause. Some breast cancers are made to grow faster by a natural hormone called estrogen. Anastrozole decreases the amount of estrogen the body makes and helps to slow or reverse the growth of these breast cancers.How to use AnastrozoleRead the Patient Information Leaflet if available from your pharmacistbefore you start taking anastrozole and each time you get a refill. If you have any questions, ask your doctor or pharmacist.Take this medication by mouth with or without food as directed by your doctor, usually once a day.Use this medication regularly to get the most benefit from it. To help you remember, take it at the same time each day.Do not increase your dose or use this drug more often or for longer than prescribed. Your condition will not improve any faster, and your risk of serious side effects will increase.Since this drug can be absorbed through the skin and lungs and may harm an unborn baby, women who are pregnant or who may become pregnant should not handle this medication or breathe the dust from the tablets.Side Effects:Hot flashes, headache, trouble sleeping, dizziness, stomach upset, nausea/vomiting, constipation, diarrhea, loss of appetite, weight gain, tiredness/weakness, increased coughing, or sore throat may occur. If any of these effects last or get worse, tell your doctor or pharmacist promptly.Remember that your doctor has prescribed this medication because he or she has judged that the benefit to you is greater than the risk of side effects. Many people using this medication do not have serious side effects.Tell your doctor right away if you have any serious side effects, including: bone pain, easily broken bones, joint stiffness/pain, muscle pain/stiffness, mental/mood changes (such as depression), numb/tingling skin, swelling hands/ankle/feet, shortness of breath, unusual vaginal discharge/bleeding/burning/itching/odor, pain/redness/swelling of arms or legs, vision changes, signs of liver disease (such as nausea/vomiting that doesn't stop, stomach/abdominal pain, yellowing eyes/skin, dark urine).Get medical help right away if you have any very serious side effects, including: chest/jaw/left arm pain, confusion, trouble speaking, weakness on one side of the body.A very serious allergic reaction to this drug is rare. However, get medical help right away if you notice any symptoms of a serious allergic reaction, including: rash, itching/swelling (especially of the face/tongue/throat), severe dizziness, trouble breathing...

$57.00

Boldenone 250 Magnus Pharma 10ml [250mg/ml]

Pharmaceutical name:Boldenone UndecylenateActive Life:14-16 daysAverage Dose:Men 400-600 mg/week; Women 50-150 mg/weekWater Retention:LowAromatization:LowSteroid cycle:cutting, bulkingBOLDENONE 250 MAGNUS PHARMA 250MG/ML (10ML)Boldenone – anabolic steroid known for athletes. In the markets of many countries which is also known as Boldabol, boldebol, Equipoise.COURSE BOLDENONEThe drug is widely used in medicine. Long ago it has been evaluated and bodybuilding, where it is used as one of the best steroids for a set of muscle mass.Unlike any other so-called steroid anabolic boldenone has a duration of 8 to 10 weeks.He has a good combination of properties with other anabolics. The most common courses related to the combination with agents such as testosterone, trenbolone. The weight marked course is such combination is considered to be the most successful and effective.In terms of the speed of drying, it is not a drug that is taken alone, but can also be combined with other anabolics. Mainly, combined with Winstrol and Anavar. These drugs also have good properties for burning fat and therefore merge into an integral to the effect of the drug still higher and better.Before you begin a steroid cycle, we recommend that you consult with a trainer or medical professional. During the course established by the masses, it is better to limit to 6 weeks, since the drug is able to significantly suppress its own natural testosterone production.At the end of two weeks after the end of boldenone is recommended taking testosterone enhancers. This is to ensure that the body of a bodybuilder activates the process of production of testosterone.As in many other cases, the reception of the drug can also be combined with the methods of the sports nutrition courses.DOSE BOLDENONEThe optimal dose is considered it is 400 to 800 mg. We advise not to engage in excessive doses of steroids, since it will not bring visible results, but side effects can be added to a large extent.BOLDENONE VIEWS89% of the athletes who took the medication, speaking positively of him as a preparation for a set of muscle mass.It is said that he has a good pronounced effect. Moreover, most of the athletes are satisfied with the price and the general availability of the drug in comparison with other steroids.BOLDENONE SIDE EFFECTSUnlike some other steroids, thanks to its structure, the drug does not transform properties into estrogens.Therefore, in this kind of unpleasant side effects such as Gynecomastia, edema and pressure peaks do not worry. This makes that you one of the more positive drug. During its course, there is no need to take anti-estrogens.Also, due to its low androgenic activity, which can be used by women.Usually no observable manifestations of virilization.In addition, the drug does not cause side effects such as hair loss, acne, prostate hypertrophy and in comparison with other anabolic, which suppresses less own male testosterone production.BUY BOLDENONEIf you decide to buy anabolic steroids, the decisive factors for which it is the quality and the price. Therefore, we recommend that be directed your attention to our shop online. We work directly only with well-known manufacturers of anabolic steroids, which ensures its originality and authenticity. In addition, we have completely eliminated work with intermediaries, which makes our price as low as possible for you. In addition, you have the opportunity to use discounts and bonuses of our shop, participating in a variety of regular promotions. We do everything possible to make sure that you are satisfied and we have advised their friends and relatives. Book a drug right now, don’t waste your time and our experts will deliver it anywhere in the country...

$65.00

CJC-1295 DAC - 2mg Magnus Pharma

PRODUCT NAME: CJC-1295 DAC 2MGSUBSTANCE: PEPTIDEMANUFACTURER: MAGNUS PHARMACEUTICALSProduct DescriptionCJC 1295 with DAC Peptide Magnus PharmaceuticalsThe CJC 1295 with DAC Peptide Magnus Pharmaceuticals is a so-called GHRH peptide. That is, It ensures an increased release of body growth hormone. As well as an increase in the body‘s concentration of IGF-1. These peptides are well suited to build more muscle mass and also to reduce the body fat percentage over the long term.CJC 1295 with DAC Peptide Magnus Pharmaceuticals has a very long half-life of several days. It significantly increases the release of growth hormone by the adenohypophysis.CJC 1295 with DAC Peptide Magnus Pharmaceuticals is, so to speak, the „extended release“ variant of a GHRH peptide. In the long term, it supports the body‘s secretion of growth hormone at a higher level. For example, for a generally better well-being.The Benefits of CJC 1295 with DAC Peptide Magnus Pharmaceuticals:Increased sexual drive CJC 1295 with DAC Peptide Magnus PharmaceuticalsImprovement of the immune system by CJC 1295 with DAC Peptide Magnus Pharmaceuticals applicationCJC 1295 with DAC Peptide Magnus Pharmaceuticals radically increases the IGF1 productionImprovement of bone density by CJC 1295 with DAC Peptide Magnus PharmaceuticalsCJC 1295 with DAC Peptide Magnus Pharmaceuticals increases protein synthesisImprovement of organ functions by CJC 1295 with DAC Peptide Magnus PharmaceuticalsReduction of abdominal fat by CJC 1295 with DAC Peptide Magnus Pharmaceuticals CureImproves energy and vitality with CJC 1295 with DAC Peptide Magnus PharmaceuticalsCJC 1295 with DAC Peptide Magnus Pharmaceuticals improves the skin toneImproves endurance with CJC 1295 with DAC Peptide Magnus PharmaceuticalsAccelerates wound healing by CJC 1295 with DAC Peptide Magnus PharmaceuticalsCJC 1295 with DAC Peptide Magnus Pharmaceuticals strengthens the heartIncreases sleep quality CJC 1295 with DAC Peptide Magnus PharmaceuticalsPositive effects on the eyes CJC 1295 with DAC Peptide Magnus PharmaceuticalsCJC 1295 with DAC Peptide Magnus Pharmaceuticals is structurally closely related to the body-specific GHRH peptide hormone.However, since GHRH itself is quite expensive and expensive to produce and has only an extremely short time of action, it is generally not used by users, for example bodybuilders or other athletes. The American / Canadian biotechnology company ConjuChem therefore developed a modified new peptide, comprising the first 29 amino acids of GHRH, starting from the structure of the natural, 44 amino acid GHRHs. In addition, a so-called DAC ( „drug affinity complex“) based on the amino acid lysine was added to the new peptide in a method developed by ConjuChem.This DAC prevents the early degradation (degradation) of the peptide and increases the half-life by drastically up to 7 days by the peptide selectively binding to freely circulating albumin during the so-called bioconjugation after injection. Due to this, the concentration of CJC 1295 with DAC Peptide Magnus Pharmaceuticals remains at a uniform level after injection, which gradually decreases over several days.CJC 1295 with DAC Peptide Magnus Pharmaceuticals strengthens the body‘s secretion of growth hormones:The acute delivery of the peptide itself does not elicit an immediate growth hormone pulse in the adenohypophysis. Instead, the peptide continues to increase the amplitude of naturally-distributed waves of growth hormone secretion throughout the day. Furthermore, CJC 1295 with DAC Peptide Magnus Pharmaceuticals also increases the production of IGF-1 in the liver. This results in further anabolic (and thus desirable for athletes) desirable effects.While normally an increase in growth hormone secretion also provides an increase in the concentration of the hormone prolactin, it remains within the scope of the supply of CJC 1295 with DAC Peptide Magnus Pharmaceuticals. High prolactin values reduce libido in men and can lead to impotence as well as mental problems (especially impotence).Since CJC 1295 with DAC Peptide Magnus Pharmaceuticals improves the secretion of growth hormone as well as prevents prolactin concentration increase, the protein biosynthesis in the body also proceeds more efficiently. This also promotes the development of new muscle masses. Furthermore, CJC 1295 with DAC Peptide Magnus Pharmaceuticals can also trigger the breakdown (lipolysis) of adipose tissue by its effect on growth hormone secretion. Increase bone density or promote cell renewal in damaged or aged tissue.When, how and for what is CJC 1295 with DAC Peptide Magnus Pharmaceuticals used and dosed?As described above, CJC 1295 with DAC Peptide Magnus Pharmaceuticals ensures that the adenohypophysis releases larger amounts of growth hormone over a longer period of time.Therefore, the peptide is particularly suitable for users who are not able to inject frequently and for users. Want to find a basic way to increase their growth hormone concentration. Instead of reaching a point-by-point maximization of growth hormone secretion.In this way, the peptide provides in the background, so to speak, for the user to achieve better results in terms of muscle build-up or fat loss. If the other factors in the execution of your own training and nutritional plan are also consistent in themselves and are adhered to.As a rule, CJC 1295 with DAC Peptide Magnus Pharmaceuticals is injected twice a week (every 3 to 4 days) with 1 mg each.The best time for injection of CJC 1295 with DAC Peptide Magnus Pharmaceuticals is in itself before going to bed. Since the peptide, according to many reports, can also provide for a relaxing and regenerative effective sleep.Side effects are rarely associated with the use of CJC 1295 with DAC Peptide Magnus Pharmaceuticals. There may be joint pain or slight numbness in the hands and feet.Muscle Mass Composition Combination Mod GRF 1-29 and CJC 1295 with DAC Peptide Magnus Pharmaceuticals:Thus, as can be seen, both CJC 1295 with DAC Peptide Magnus Pharmaceuticals and Mod GRF 1-29 are thus GHRH peptides with identical mode of action. Their difference is due to their widely differing half-life. This allows for the repeated injection of the peptide several times a day (and makes it practically necessary for meaningful results at the same time). At least 3 hours should elapse between injections.The number of injections can be adapted to individual wishes and needs. And moves with most users between 2 and 3 times a day. Investigations have shown that a dose of 100 mcg Mod GRF 1-29 is sufficient to completely occupy the corresponding receptors in the adenohypophysis. Thus, the injection of more than 100 mcg of Mod GRF 1-29 at once results in only a slight increase in the effect of secretion of additional growth hormone.What makes sense, however, is the combination of Mod GRF 1-29 with a GHRP peptide, e.g. GHRP-6.There is a strong synergy between these types of peptides. While the GHRP peptide triggers a growth hormone pulse, it is amplified by Mod GRF 1-29. For example, the supply of 100 mcg of GHRP-6 and 100 mcg of Mod GRF 1-29 leads to the same secretion of growth hormone as if 300 mcg of GHRP-6 had been added. In general, the combination of Mod GRF 1-29 and a GHRP peptide makes sense for all users who want to dispense with expensive – and often fake – synthetic HGH. The use of these peptides stimulates and enhances the body‘s production of growth hormone rather than externally adding growth hormone. Because of this more natural course for the body, Mod GRF 1-29 does not necessarily have to be gecycled, but can also be used theoretically permanently...

$52.00

Drostanolone 100 Magnus Pharma 10ml [100mg/ml]

Pharmaceutical name:Drostanolone PropionateActive Life:2-3 daysAverage Dose:Men 300-500 mg / weekWater Retention:NoAromatization:NoneSteroid cycle:cuttingDROSTANOLONE 100 MAGNUS PHARMACEUTICALS 100MG/ML (10ML)The tested drug that is widely used in modern bodybuilding. Also found in the market under names such as Masteron, drolban, metormon, permastril.DROSTANOLONA PROPIONATE COURSEThe course of drugs is shown only to healthy adults have no health problems. We recommend that before you start taking the drug undergo a medical examination to determine any contraindications regarding its reception.The product due to its composition can also combine and combine with many anabolic today known.Due to its properties, which can easily be combined with medications like Winstrol and oxandrolone.Don’t forget the presence in their diets for sports complexes date and nutrition sports, rich in proteins, mainly.DROSTENOLONA DECANOATE DOSEAccording to the manufacturers, the dose of the drug to bodybuilders healthy adults is approximately 400-500 mg per week. Pay attention to the fact of that the increase of the dose of the drug that did not result in an improvement of the effects of taking it, but will only lead to an increased risk of side effects.Of course, as in any other case, any anabolic dose depends on many factors, including physiological characteristics of an athlete. So that for beginners can be reduced somewhat.DROSTENOLONA DECANOATE VIEWSAccording to bodybuilders, the drug has good properties of accumulation in muscle, increase strength gains and the motivation of an athlete, burning excess body fat, increases appetite and muscle endurance during training.DROSTANOLONE PROPIONATE SIDE EFFECTSThis drug has a lower rate of anabolic, so while you have good fat burning properties, however, can increase the risk of side effects of androgenic, know, acne, baldness, prostatic hypertrophy.Women taking the drug may cause virilization symptoms.A good positive aspect of this drug are its properties do not cause water retention in the body. It also has a relatively low toxicity for the liver and the human kidneys.BUY DROSTANOLONE PROPIONATEIn order to buy all the required anabolic now they do not have to run in search of a reliable dealer and low-cost. We are willing to come to your aid. We enjoy a good reputation and credibility with the athletes, so trust in us can be sure that you’re getting quality products at very low prices. We also have the wider range of stores online. For us it is important to have each customer, so we have introduced a system of review and bonuses for them. Don’t waste your time, please contact us to request a medication and start your way to a good and beautiful body. Write your comments. Therefore, we can help and make our work more pleasant and more efficient for you. Order these and other drugs can be on our web site...

$70.00

Follistatin-344 Peptide Magnus Pharma

Manufacturer: MagnusQuantity: 1mgPackage: 10mlSteroid cycle: growthActive principle: Follistatin 344Product DescriptionFollistatin-344 Peptide Magnus PharmaceuticalsFollistatin-344 Peptide Magnus Pharmaceuticals is a specific protein or peptide. It specifically inhibits the release of the quasi-negative stimulating hormone myostatin (Myostatin blockers). Which is responsible for the limitation of the muscle build-up, as well as for the breakdown of musculature. Follistatin is therefore the opponent of Myostatin. Follistatin-344 Peptide Magnus Pharmaceuticals is therefore a naturally occurring peptide. Follistatin-344 Peptide Magnus Pharmaceuticals is an extremely potent and effective myostatin inhibitor (myostatin blocker).The Benefits of Follistatin-344 Peptide Magnus Pharmaceuticals:Follistatin-344 generally provides for the increase of muscle massIncreased Strength and Endurance by Follistatin-344 Magnus PharmaceuticalsIncrease in the overall muscle volume by the myostatin blocker Follistatin-344 Peptide Magnus PharmaceuticalsFollistatin-344 Peptide Magnus Pharmaceuticals provides greater muscular strain, resulting in more growthThe myostatin blocker Follistatin-344 Peptide Magnus Pharmaceuticals improves sleepThe peptide Follistatin-344 Peptide Magnus Pharmaceuticals additionally strengthens the joints and the connective tissueFollistatin-344 strongly supports fat burningThe effect of Follistatin-344 Peptide Magnus Pharmaceuticals:As already briefly mentioned, myostatin promotes the breakdown of so-called myotubes, ie skeletal muscle fibers. This ultimately results both in the inhibition of muscle building and in general in muscle breakdown. In addition, the protein myostatin controls muscle muscle growth by preventing uncontrolled growth of the skeletal muscle. Follistatin-344 Peptide Magnus Pharmaceuticals plays the leading role in the regulation of myostatin. It acts like a very precise filter in the skeletal muscle and filters the muscle-building-inhibiting proteins. This is how the name Myostatin Hemmer comes about.Use Follistatin-344 Peptide Magnus Pharmaceuticals as Myostatin Blocker:Most peptides are designed to increase the body‘s growth hormone distribution. In collaboration with exogenous or body-borne testosterone and insulin to form the maximum level of IGF-1. In order to achieve maximum muscle growth. But now the research is as far as to deal with peptides, which inhibit the production of myostatin.Ingestion and ingestion of Follistatin-344 Peptide Magnus Pharmaceuticals:According to the US forums, the most promising doses of 100mcg daily for 10 days, with a subsequent 10-day break. This cycle is repeated as desired. Another very low dosage is given to the injection of 100mcg every 10 days. In addition, the combination with GHRP 2 or GHRP 6 or the use of PEG MGF is recommended to increase the anabolic effects of Follistatin-344 Peptide Magnus Pharmaceuticals and to protect the joints and vision...

$74.00

GHRP-2 10mg Magnus Pharma

GHRP-2GHRP-2 (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide Growth Hormone Releasing Peptide (GHRP), which acts on the hypothalamus and the pituitary gland to release growth hormone with a slight stimulator effect on Prolactin, ACTH and Cortisol levels. GHRP-2 is considered to be a true hGH secretagogue, meaning that it stimulates the body’s own secretion of hGH. Human Growth hormone has been shown in studies to promote lean body mass and reduce adiposity (fat). GHRP2 has demonstrated that it is very effective at stimulating GH production in research test subjects. It has a short half life with peak concentrations occurring around 15 minutes and not longer than 60 minutes after administration. GHRP-2 PeptideSequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2Molecular formula: C45H55N9O6Molar Mass: 817.9CAS number: 158861-67-7PubChem: CID 6918245 Synonyms: Growth Hormone Releasing Peptide-2; GHRP2; GHRP 2GHRP2 (Growth Hormone Releasing Peptide 2) also known as PralmorelinGHRP-2 and GRF Analogue Interactions (CJC-1295 / Sermorelin)It is important to know that GHRP-2 does not relate to any Growth Hormone Releasing Hormones (GHRH) peptides such as Sermorelin and CJC-1295 because it acts on different receptors. However, greater results occurred when administered in conjunction with a Growth Hormone Releasing Hormone (GHRH) such as Modified GRF 1-29 or CJC-1295 DAC. Naturally, these GHRP-2 peptide receptors interact with a hormone called ghrelin. Growth hormone releasing peptide 2 is a commercially synthesized, non-natural super-analog of GHRP-6 which is capable of potent stimulatory effect on growth hormone (GH) secretion with slight stimulator effect in PRL, ACTH and levels of cortisol (Arvat et al. 1997). It is also a synthetic agonist of ghrelin that is binding with the growth hormone (GH) secretagogue receptor. GHRP-2 has been shown to affect and induce growth hormone secretion. The response of natural physiologic system includes increase in levels of calcium ion influx alongside with increased release of growth hormones in response to this peptide (Wu et al. 1994). Comparing GHRP-2 and GHRP-6 (Growth Hormone Releasing Hexapeptide)GHRP-2 is a 2nd generation GHRP just behind GHRP-6. Compared to GHRP-6, GHRP-2 is considered to be much more superior in terms of growth hormone stimulation because over longer periods of time it maintains maximum elevations in Growth Hormone. GHRP-2 has shown to increase IGF-1 levels (Insulinlike Growth Factor 1), and even greater results happen when used with Growth Hormone Releasing Hormone (GHRH). It has a short half life with peak concentrations occurring around 15 minutes but not longer than 60 minutes. The response of natural physiologic system includes increase in levels of calcium ion influx alongside with increased release of growth hormones in response to the high-amplitude pulsation from the GHRP-2. GHRP-2 and other ghrelin analogues increase the number of somatotropes involved in the GH pulse by inhibiting somatostatin, GHRH increases the pulse amplitude per pituitary cell or somatotrope by other means. Unlike ghrelin, GHRP-2 is not lipogenic which means that it does not induce fat storage. Although ghrelin plays a large role in hunger, GHRP-2 as an analog of ghrelin does not increase appetite significantly. The Utility of GHRP-2 as a Growth Hormone SecretagogueGHRP-2 has been studied extensively for its utility as a growth hormone secretagogue (GHS). Scientists have discovered that the Growth Hormone Releasing Peptide-2 increases the natural production of growth hormone (GH). In the early 90’s, one of the most famous studies was performed and later published in 1997 in the Journal of Endocrinology and Metabolism. This study further exemplifies the theory that growth hormone releasing peptides (including Ipamorelin and GHRP-6) could help hormone deficient adults and children. Ever since these major scientific studies, GHRP-2 has been widely produced. With other scientific labs confirming the results from their studies, GHRP-2 can in fact work for those who lack the ability to make adequate human growth hormone. Results however will differ with the use of GHRP-2 because species respond differently based on the pituitary somatotrophs and the differences in the subtypes of GHRP receptors. In the physiologic system, the actions are blocked by GRF receptors antagonist which acts through a different receptor to that employed by earlier GHRPs...

$42.00

GHRP-6 10mg Magnus Pharma

GHRP-6GHRP-6 is a potent stimulator of natural Growth Hormone release. GHRP-6 is a Hexa-peptide that promotes food intake by stimulating hunger and helps increase energy metabolism. Growth Hormone Releasing Peptides, similar to GHRP-6, are most commonly used for treatment of Growth Hormone (GH) deficiencies, eating disorders, obesity, etc. Research has shown that use of these HGH Peptides increases lean muscle mass, strength, stamina and decreases body fat.GHRP-6 PeptideSequence: His-D-Trp-Ala-Trp-D-Phe-Lys-NH2Molecular formula: C46H56N12O6Molar Mass: 873.014 CAS number: 87616-84-0 PubChem: 5486806 Synonyms: Growth Hormone Releasing Peptide-6; GHRP6; GHRP 6Growth Hormone Releasing HexapeptideThe Development of GHRP-6In 1982, the natural hormone "Growth Hormone Releasing Hormone" (GHRH) was identified after a prolonged search. Soon, researchers discovered that those GH-Releasing Peptides (specifically GHRP-6 & GHRP-2) followed a mode of action which bound them to and was mediated through receptors different from those for GHRH. Furthermore, researches discovered that these GH-Releasing Peptides acted synergistically with the natural hormone Growth Hormone Releasing Hormone (GHRH), which is related to Sermorelin, in both laboratory animals and humans to produce large releases of Growth Hormone. In the 1980s, the first highly potent GH-Releasing peptide, GHRP-6, was developed. Due to a strong GH release response from the the peptide, it became the first member of a class called Growth Hormone secretagogues. GHRP-6 is a hexapeptide composed of 6 amino acids: L-Histidine, D-Tryptophan, L-Alanine, L-Tryptophan, D-Phenylalanine and L-Lysine. The "L" form of an amino acid is the naturally occurring form and often in the nomenclature the "L" is dropped. The "D" form does not occur in nature and is the isomeric form (i.e. mirror image) of the naturally occurring "L" form. GHRP-6 (His-D-Trp-Ala-Trp-D-Phe-Lys-NH2) is composed of both natural and isomeric forms of those 6 amino acids.This sequence provides a signal to the body to begin secreting Growth Hormone release while also blocking Somatostatin, a hormone that inhibits the release of Growth Hormone.Studies Related to the GHRP-6 PeptideInvestigations reported that GHRP-6 is more efficient than GHRH itself in monkeys and performs synergistically when combined or applied together. An example of this combination would be GHRP-2 and CJC-1295. GHRP-6 is believed to be acting naturally on both pituitary and hypothalamic sites (Fairhall et al. 1995). In a time-dependent and dose-dependent manner, the primary pituitary cells of rats were demonstrated on. From the studies, the concentrations of the GHRP-6 needed for the half-maximal and maximal stimulation were 7 x 10(-9) and 10(-7) M, respectively.In another study, it was concluded that the major target of the GHRP-6 in vivo (both laboratory animals and humans) is the hypothalamus. From the observation, it was concluded that the GH release induced by the central GHRP-6 injections in guinea pigs was inhibited by the central action of somatostatin. Furthermore, an inhibition by somatostatin with the activated GRF neurons, induced by GHRP-6, was observed via receptors known to be located on or near the GRF themselves. This particular experiment further indicated that GHRP-6 is effectively stimulating GH release from somatotrophs through different receptors, the mechanisms of which are not yet known (Chan et al. 1989).Determining how efficient and the actions of the growth hormone is dependent on the physical condition of the experimental unit. For example, in humans, GH secretion decreases with obesity. On the other hand, GHRP-6, similar to Hexarelin, showed in one case increased (almost twice that of GHRP) GH responses when administered in obese patients (Cordido et al. 1993). Though obesity has shown affecting the efficiency of the hormone, it was also suggested that GHRP-6’s effects were found to be sex- and age-independent without being affected by the noadregenic pathways using the a2 adrenergic receptors (Penalva et al. 2008).GHRP-6 and the Growth Hormone Secretagogue ReceptorGHRPs are not simply surrogates of GHRH, instead GHRP-6 is an artificial activator of a separate newly discovered receptor called Growth Hormone Secretagogue Receptor (GHS-R). Soon Ghrelin was discovered, the endogenous ligand that binds to the GHS-R. Both Ghrelin and all the synthetic compounds such as GHRP-6 were termed "Growth Hormone Secretagogues" (GHSs). One side effect of GHRP-6 is a significant increase in appetite due to stimulating the release of Ghrelin, a peptide that is released naturally in the lining of the stomach that increases hunger and gastric emptying. Also, GHRP-6 causes stimulation of the anterior pituitary gland which causes an increase in Growth Hormone release. The increased amounts of Growth Hormone can cause the liver to secrete the hormone IGF-1, which improves the animal body’s ability to burn fat and build muscle. Since GHRP-6 acts directly on the feedback loop which signals the inhibition of Growth Hormone release, GHRP-6 can re-stimulate the production of Growth Hormone...

$42.00

HGH FRAGMENT 2MG MAGNUS

HGH FRAGMENT 2MGUnit Size 2 mg/vialUnit Quantity 1 vialPurity (HPLC)  98.17%Sequence  Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser- Val-Glu-Gly-Ser-Cys-Gly-Phe{MonoMolecular Formula C78H123N23O13S2Appearance Chemical SynthesisStorage Lyophilized FRAGMENT 176-191 is Stable at room Temperature for 90 days, however it is best to storer in   freeze below - 8c for any extended period of time. After reconstitution FRAGMENT 176-191 should be  refrigerated at temperatures not to exceed 35 F."Terms The products we offer are intended for laboratory research use only. Please familiarize yourself with our terms of service prior to ordering...

$26.00

HGH Fragment 5mg Magnus Pharma

Today, their attention is a unique product. Like the majority of other hormones, which is designed for fast and efficient recruitment of muscle mass and has a number of other issues, in particular, the problems associated with obesity excess.An important feature of this hormone is that it does not interact with the growth hormone receptor, but increases the expression of the gene of the receptors beta-3 adrenergic, which cause lipolysis in body. He is considered to be the principal mechanism of action of the drug.Course peptidesDoses are in the range of 250 to 1000 micrograms per day, the course lasts, on average, around 2-3 months. Injections are performed between meals. This is done in order to create more favorable conditions for fat burning. The drug is diluted in an isotonic solution or water for injections, which are bought in pharmacies. For maximum effect, they must follow a diet to lose weight and take one sufficient amount of protein.Also, don’t forget a very important feature. Throughout the course, it is very important to follow a low-calorie diet. We know that after a meal increases the levels of insulin, and insulin, a hormone that stimulates the digested CAMP Phosphodiesterase – second Messenger molecule which inhibits lipolysis process (which is why it is important to not eat immediately after the injection and other peptides), as the growth hormone pulsatile secretion occurs during the 3 hours after administration (, and only for the first wave of insulin hours will have to work, and the remaining two hours – fat burning, as the effect of a derivative of the growth hormone). Therefore, that the injections are carried out between meals, on an empty stomach.Pay your attention to the fact that the increase in the duration of the course does not guarantee an increase in the results. Why does this happens? This is due to a moderate gradual action of the drug, since increased her dosage in excess of the optimal location or the extension of the duration of the course does not lead to the expected rezulatatam.Opinions peptidesAthletes who took drugs seem to be very well from it. Its main objective – the burning of excess body fat. In this case, the drug shows a very high efficiency. Also, in addition to this, it has a number of other useful features, among which are such as the improvement of muscle mass, normalization of metabolism in the body of an athlete, the normalization of digestion and many other effects.Peptide side effectsTo date, laboratory studies have no side effects have been found. This is confirmed and create your own account. A small inconvenience rather than a serious side effect, can be considered such as redness and pain in the area where the injection was made. It has a detrimental effect on the function of the body and human organs, their functional capabilities, the drug no. Object some of the subspecies of drug use, even children, no doubt speaking for their safety.It is proven that the hormone drugs in this category are even safer than anabolic steroids. Receipt of security due to the fact that the formulations contain ingredients that the composition and structure are essentially identical to the human body produces. Buy peptide onlineBuying drugs over the Internet is not difficult. Today on the Internet a large number of online stores that offer to their customers, but at the same time, are not immune to counterfeiting. With the purchase of a fake, they benefit not only your body, but it can also be detrimental to health.Returning to our shop online, the risk of buying low quality product, is lost since our shop is working directly with the manufacturer of steroids – the company «Pharma». In addition, because of this, the price of steroids are lower and loaded with many additional charges not.Besides all this, the purchase of drugs from us, you become a regular customer, who has the right to enjoy discounts and other bonds of money in our online store. We always keep up-to-date with the needs and desires of our customers. Unlike other vendors, the main objective is to achieve the maximum benefit, we are primarily concerned about his client and consider all your wishes. We are the best in sales and on several occasions has been tested by hundreds of satisfied customers.Make preparation for us and we are sure that you won’t regret it.You can use our experts if you have any questions. You can order the drug directly from our site and our staff quickly bring you directly to your home...

$51.00

IGF-1 LR3 1mg Magnus Pharma

IGF-1 LR3 (Receptor Grade) 1mgReceptor Grade IGF-1 LR3 is a premium research reagent for use in cell growth studies, IGF receptors and IGF binding proteins and is more potent than rH IGF-1 and Media Grade IGF-1 LR3 in-vitro due to the drastic increase in biological activity (stronger affinity for the IGF receptor). This increased biological activity is what sets Receptor Grade IGF-1 LR3 apart from Media Grade (standard) IGF-1 LR3. Media grade IGF-1 LR3 is more commonly used in commercial cell culture vs mammalian and can also be used as a research reagent at an economical cost to enable studies where biological potency is of less value. To maximize results in an animal-based in-vitro cell study or production, Receptor Grade IGF-1 LR3 should be used exclusively. The supplementation of mammalian cell cultures with Long R3 IGF-1 at a much lower concentration results in more highly elevated productivity than with standard concentrations of insulin and/or standard IGF-1. IGF-1 LR3 is better able to stimulate the type 1 IGF receptor and thus induce a higher level of intracellular signaling, cell proliferation and inhibition of apoptosis.Receptor Grade IGF-1 LR3 is more biologically active than standard IGF-1 LR3, in-vitro. Resultantly, Receptor Grade IGF-1 LR3 will deliver superior results in comparison to standard IGF-1 LR3.Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1IGF-1 LR3 (Long R3 IGF-1)IGFB Binding and The Increased Biological Activity of Long R3 IGF-1By resisting IGFBP-binding, IGF-1 LR3 has a greater effect than IGF-1. The longer duration of action allows for smaller amounts to be used with the same effects. Some IGF-1 derivatives, such as the GPE derivative, made up of just the last three N-terminal amino acids of the IGF-1 protein, have been shown to have therapeutic effects in neurological injuries like stroke. Most studies concerning the effects of IGF-1 derivatives have been carried out in non-human animal models or cell culture studies. The Sequence of IGF-1 LR3 and Muscle GrowthThe polypeptide Long R3 Insulin-like Growth Factor-I (IGF1 LR3) is an 83 amino acid analog of IGF-I actually comprising the complete IGF-1 sequence but with the substitution of an Arginine (Arg) for the Glutamic Acid (Glu) at position 3, as well as a 13 amino acid extension peptide. This sequence change causes IGF-1 LR3 to avoid binding to proteins and allow it to have a much longer half life, around 20-30 hours. This analog of IGF-1 has been produced with the purpose of increasing the biological activity of the IGF peptide.” IGF stands for insulin-like growth factor. Among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, and decreased protein degradation. When IGF is active it behaves differently in different types of tissues. In muscle cells proteins and associated cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 LR3 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF-1 LR3 prevents insulin from transporting glucose across cell membranes. As a result the cells have to switch to burning off fat as a source of energy.IGF-1 LR3 builds new muscle tissue by promoting nitrogen retention and protein synthesis. This causes the growth of muscles through both hyperplasia (which is an increase in number of muscle cells) and mitogenesis (which is the actual growth of new muscle fibers). Thus IGF-1 LR3 not only makes muscle fibers bigger, it makes more of them as well. Therefore, IGF can actually change the genetic capabilities in terms of muscle tissue and cell count. IGF increases and differentiates the number and types of cells present. IGF-1 LR3 is a synthetic analog of the naturally existing insulin growth factor (IGF) which is a 93 amino acid residue. Modifications of the natural form occurred with the substitution of the Arg with Glu at the position 3, giving a code R3, and also an extension of a 13 amino acid at the B-terminus. Just like IGF-1, R3 has been shown to induce the development and growth of cells.The studies on transgenic and knockout mice have shown that it can control its development and growth. It plays an important role as regulator in the G1 to S phase of the cell cycle. When applied to cardiomyocyte cultures, R3 have shown a large increase in proliferating cell nuclear antigen expression and in several cyclins involved in cell progression as well as in bromodeoxyuridien (BrdU) labeling (Kajstura et al. 1994). Other effects it has on cell lines are increased cell survival, inhibition of the apoptotic pathways, culture longevity and increased recombination of protein production (Fang et al. 1997). In another study, the application of the LR3 IGF-1 has led to an increase in the myocyte bromodeoxyuridine uptake by three to fivefold. But it has also shown that IGF-1 LR3 actions have been blocked by the ERK and P13K labeling which completely abolished the BrdU uptake. Furthermore, ut has been shown that in mycocytes, IGF-1 R3 stimulates the cardiomyocyte division in vivo (Sundgren et al. 2003). It has also been suggested that IGF-1-Long 3R is more potent than the IGF-1 because of its low binding capacity with all known IGF binding proteins (Tomas et al. 1995). In another investigation, feeding of LR3-IGF-1 in different amounts to investigate the effects on somatotropic axis (plasma levels of IGF-1 and 2, IGFBPs) was done. They have reported that plasma Long-R3 increased when administered subcutaneously but with no such behavior when administered orally. Furthermore, LR3 lowered the levels of native IGF-1 in rbGH-injected in calves, but L-R3 increased the amounts of IGF-II concentrations when administered with L-R3 subcutaneously. The parenteral administration of the Long R3 IGF-1 decreased the growth hormone concentration but did not affect the secretory system. It was also reported that the somatotrophic acis is basically functioning in neonatal calves and can be influenced by nutrition, growth hormone and Long-R3-IGF-1 (IGF1-LR3). (Hammon and Blum 1997).The Half-Life of IGF-1 LR3 and its Effects of IGF-1It has a considerably longer half-life than other form, nearly 20-30 hours. When IGF-1 LR3 is active, has multiple effects on tissues in muscle cells. It plays a essential role in muscle renewal. IGF-1 LR3 encourages both increase as well distinction of stem cells. IGF-1 LR3 increases satellite cell activity, muscle DNA, muscle protein content, muscle weight and muscle cross sectional area. The importance of IGF-1 LR3 lies in the fact that all of its obvious effects work to induce muscle growth. These effects are enhanced when combined with weight training.Protein creation is better along with amino acid absorption as a source of energy. It enhances use of fat as energy. In lean tissue, IGF-1 LR3 prevents insulin form carrying glucose across cell membranes, as a result, the cells have to change to burning off fat as a source of energy. IGF-1 LR3 also mimics insulin in the human body.Perhaps the most remarkable also strong influence it has on the human body is its ability to cause hyperplasia, which is an definite splitting of cells. Hypertrophy is what ensues during weight training; it is an increase in the size of muscle cells. Adult humans have a fixed number of muscle cells, that can become larger with training, however the number of muscle sells does not increase. But, with this preparation use you are able to induce hyperplasia which actually increases the number of muscle cells present in the muscle. Research studies show that with weight training the new cells develop faster and become stronger and more dense. IGF-1 LR3 used in CLINICAL RESEARCHIGF-1 LR3 plays an important part in childhood growth and continues to have results in adults. It is made in the human body and is at ideal levels during puberty. In most studies, the maximum active length for research studies IGF-1 LR3 is 50 days on also 20-40 days off. The most common range used during clinical research is typically between 20mcg to 120mcg per day.During puberty, IGF is the most responsible for the natural muscle growth that occurs during these few years. There are many different things that IGF does in the human body; among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, decreased protein degradation and increased RNA synthesis. Perhaps the most interesting and potent effect IGF has on the human body is its ability to cause hyperplasia, which is an actual split-ting of cells.In muscle cells, proteins and their cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF prevents insulin from transporting  glucose across cell membranes. As a result, the cells have to switch to burning off fat as a source of energy.  Research Use of IGF-1 LR3- enlarged amino acid transporting cells- increased protein production- reduced protein degradation- amplified glucose transporting- augmented RNA combination..

$61.00

Ipamorelin 5mg Magnus Pharma

This drug belongs to the category of the peptide hormone drug class. Its main action is directed to the stimulation of the secretion of growth hormone.The characteristics of the drug can be called except that there is no visible change in the appetite of the man.Ipamorelin was synthesized in 1998 by replacing a fragment of GHRP and the introduction into the chain of elements such as GABA (gamma-aminobutyric acid), Histidine is dextro and 2-naphthylaminePeptides coursePreparation affects significantly the production of growth hormone. This hormone is the latest generation of this type of hormonal drugs.The maximum permitted dose of the drug is 100 micrograms. It is best to inject the medication in the body parts – 2 or 3 times a day. This is not only very convenient to host, but that it also allows you to concentrate better in preparation before the start of the action.On the other hand there to highlight the increase in dose. Studies have shown that the optimal dose of the drug (100 mg), receivers fully loaded. However, if the dose add the effect will be only 25% more. What does it mean? This means that, in principle, the addition of dose inadequate, since this will not lead to a difference in the final result.On the other hand, if blindly increasing the dose of the medication, will only lead to a reduction of its anabolic effect, and therefore such experiments are not feasible.It has its characteristics in the preparation and storage of the drug. You must cool down in any way, add some water so that it flows along the walls of the vial and mix the hands rotating in a circular motion. Do not move or shake the bottle with the liquid.In a cool place, such as a refrigerator freezer without transformation and preparation normally they can be stored for 20-25 days.Reviews peptidesIf we look at the responses of athletes, we can see that the majority is trying to compare a drug with other similar substances. In principle, they can be used together in a course of combined type.If it is scanned with other hormones, it can be concluded that this drug is the best of all others, since it is considered to be the safest. Even in the case of high doses which practically does not increase the production of cortisol and prolactin.It is precisely a new peptide, which is able to solve many problems.Peptides side effectsAs mentioned previously, this preparation is basically recognized as one of the safer even for the Fund similar preparations. Why? This is achieved through a special structural formula, in the more pronounced anabolic effect and an impact moderated on the human body.Unlike many other drugs, the course of peptide practically does not need additional operations to prepare the body for the course. Basically, for those who want to be safe, once again, it is possible to pass a medical exam and need to verify the absence of, for example, an allergic reaction components of the drug in the body of the athlete.Another feature, having peptide is the increase in phases of deep sleep, implying a greater natural production of natural growth hormone.Buying peptides onlineIf you are looking where to buy quality hormones, we recommend to pay attention to our online store. Why? Since we can guarantee the quality of our products, the price is the lowest in us. A lot of positive feedback is proof of this. We have confidence in the quality of our products and we can safely guarantee their quality.Only here is the opportunity to receive additional bonuses, who came to the club from our loyal customers. Write your comments, leave them on our website. We would appreciate the views and desires of each client. In this way, it will help make our work better and more effective and more enjoyable for you. Our store has the range schirokim of drugs on the market. Because of this any buyer can be purchased by itself a drug which is more closer to your needs. By contacting with us, you won’t regret it. No, we have been knowing the title of the most popular and reliable supplier. Through our work hundreds of bodybuilders have been able to achieve their dreams – has a beautiful and powerful body. Picking can be on our website or call for help. Hurry, since the supply of our actions is limited! Have time to buy the drug, to be the first to feel the results for yourself...

$63.00

Methandienone Magnus Pharmaceuticals 100tabs [10mg/tab]

Pharmaceutical name:MethandienoneActive Life:6-8 hoursAverage Dose:Men 50-100 mg/day; Women 20-50 mg/dayWater Retention:YesAromatization:Yes, similar to testosteroneSteroid cycle: bulkingMETHANDIENONE MAGNUS PHARMACEUTICALS 10MG / 100 TABSMethandienone – a drug related to a series of anabolic steroids-left, he was gaining popularity as a drug used in sports medicine to increase muscle mass. The drug increases anabolic processes and inhibits catabolic processes caused by corticosteroids, helps increase muscle mass, it creates a positive nitrogen balance, accelerate the decomposition of body fat, suppresses the immune response by increasing synthesis inhibitor fraction C-1 of a compliment, and reducing P-2 P-4 fractions fulfilled, when taken regularly, actively developing secondary sexual characteristics of male type.Methandienone courseBefore the course starts receiving the drug should remember one important feature: the body can get used to receiving the steroid, and he can not bring the desired effect. Therefore, perhaps the most important rule is to gradually increase the dosage of the drug.In addition, it is recommended to take the drug 6-9 and 18-21 hours. This is because at this time the blood level of testosterone is the male highest level.Very often, the athletes taking the drug, separavan 3, and in some cases, and 4 pieces per day. Such a technique may well be valid and will not do any harm to the body.The initial phase of the course is approximately 3-4 weeks. As a rule, this course is used by beginners or athletes, who for some reason are not trained for a long time (eg due to injury).This course also allows you to avoid the effect of habituation of the organism.Since the drug increases appetite, it would be right to take the methane before a meal – this will allow you to use a larger amount of protein (which is, in principle, and need to know). The food that enters your body after ingestion of the drug, will serve as a source of energy and, above all, for the building blocks of muscle.Methandienone doseThe daily dose should be 20-25 mg. As already mentioned, allows distribution on the part of the reception. After the course, you are sure to make a post-cycle therapy and restore your liver.In addition, athletes with experience to increase the dose, thus avoiding the undesirable effect of habituation. However, in this case, it should be noted that the drug is still quite powerful, and therefore increase your dose is slowly and in small quantities, while constantly keeping an eye on their own welfare and undergo a medical examination , as necessary.Methandienone side effectsA significant excess of the standards set taking the drug, as well as potential health problems that the athlete can cause side effects.According to doctors who examined athletes taking the drug, as well as athletes, most often side effects such as progression of atherosclerosis, peripheral edema, dyspeptic symptoms, dark urine, nausea, vomiting, general fatigue manifest, flatulence, insomnia.Women can have a demonstration virilization (clitoral enlargement, deepening or hoarseness, disco and amenorrhea, hirsutism, steroid acne, oily skin), hypercalcemia (CNS depression, nausea, vomiting, fatigue). In addition, some men, depending on the physiological characteristics of the organism may occur in prepubertal – virilismo (acne, penis enlargement, priapism, formation of secondary sexual characteristics), hyperpigmentation of idiopathic skin, slow or stop the growth (calcification areas epiphyseal growth of long bones); postpubertal – bladder irritation (increased urinary frequency urgency), mammalgia, gynaecomastia, priapism, reduced sexual function; elderly athletes – hyperplasia and / or prostate carcinoma.In case of overdose hepatotoxicity it is possible. The treatment in this case is a gastric lavage, the appointment of symptomatic therapy.methandienone reviewsIn the view of the famous American bodybuilder Lee Haney, he said the drug has a significant impact on growth and strength training athlete, increases energy levels and has a positive effect on the overall physical condition of the athlete.Methandienone BuyThis drug belongs to a group of substances that are not available commercially.But you can order via the Internet shop, there are now many. However, buying a product from an unknown seller runs the risk of buying a fake.We guarantee the quality of our products as we are direct suppliers delas factories.It is also our great advantage compared to other stores is that we work without intermediaries, and this in turn influences the final price of the product and makes it more competitive than its competitors.Contact our online store, and make your order now. If you have any questions, ask our experts for a comprehensive response...

$39.00

Showing 1 to 12 of 28 (3 Pages)